PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G029200.1
Common NameB456_002G029200, LOC105775272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 679aa    MW: 74506.7 Da    PI: 6.0441
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G029200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-29216269155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Gorai.002G029200.1 216 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 269
                         79*******************.********************************8 PP

2Response_reg74.44.3e-25381461109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ + +l+++l++  y +v+ +  +e al +l+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + 
  Gorai.002G029200.1  38 VLVVDDDPTCLIILEKMLRNCSY-DVTKCNRAETALLKLRENRngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKDVVMKG 126
                         89*********************.***************99999***********************6654.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Gorai.002G029200.1 127 VTHGACDYLIKPVRIEALKN 146
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.5E-17411670IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.3E-4135176No hitNo description
SuperFamilySSF521721.57E-3535160IPR011006CheY-like superfamily
SMARTSM004482.7E-2936148IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.09737152IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.0E-2238146IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.87E-2639151No hitNo description
PROSITE profilePS5129411.048213272IPR017930Myb domain
SuperFamilySSF466893.58E-20213273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30215274IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-25216269IPR006447Myb domain, plants
PfamPF002499.7E-8218268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MKNSSGGKGS MSTASSITTW KAGDVVPVPD QFPAGLRVLV VDDDPTCLII LEKMLRNCSY  60
DVTKCNRAET ALLKLRENRN GFDIVISDVH MPDMDGFKLL EHIGLEMDLP VIMMSADDGK  120
DVVMKGVTHG ACDYLIKPVR IEALKNIWQH VVRKRKNEWK DLEQSGSVEE GDRQPKQSED  180
ADYSSSVNEG NWKSSKKRKD DEDETEDRDD TSTLKKPRVV WSVELHQQFV AAVNQLGIDK  240
AVPKKILELM NVPGLTRENV ASHLQKYRLY LRRLSGVSPH SCNPNNSFMN PQDETFGPLS  300
SVHGLDLQTL TATGQLPAQC LATLQAAVLG RSTAKSSIPM PLVNQRNIFS FENPKLRFGE  360
GQQQHVNNNN KQVNLLHGIP TTMESKQLTS LRRTSQSIGN VSMQVAPHGA QSSQNNSSLI  420
EMGQPLSRVQ ILNDSTVPLS VGQPIVPNGI AANVSTRNGI PENIRAPGYN LVSQTSSILN  480
FPMNHASELP VDSFSLRSTP GMSDHTSKGA FHEDFNSEIK GSGGFLPTYD VFNDYQYKSQ  540
NWELQNAGMI LEDSQHSNSL QGNLDLAQSV LVQQGFPSGQ INGQNRSVPI VSKAMFSAGD  600
STEPGNLLNV NHHLNTIRAE NTVRVKSGSV ADGNPSNLFA DHFGQEDLMI ALLKQQQGIA  660
PAENEFDFDG YSLDNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22215275464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5879302e-76JX587930.1 Gossypium hirsutum clone NBRI_GE22201 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453255.10.0PREDICTED: two-component response regulator ARR2
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A0D2NHH80.0A0A0D2NHH8_G
STRINGGLYMA07G37220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]